puzzle picture
1699: Revisiting Puzzle 60: Beta Barrel
Status: Closed

Summary

Name: 1699: Revisiting Puzzle 60: Beta Barrel
Status: Closed
Created: 07/15/2019
Points: 100
Expired: 07/22/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams12,789100
2Beta Folders12,69476
3L'Alliance Francophone12,57456
4Marvin's bunch12,55641
5Go Science12,45929

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 24 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Roll out the barrel...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons