puzzle picture
1696: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed

Summary

Name: 1696: Revisiting Puzzle 59: TCR Binding Protein
Status: Closed
Created: 07/08/2019
Points: 100
Expired: 07/15/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,136100
2L'Alliance Francophone10,10071
3Go Science10,08849
4Gargleblasters10,08633
5Hun-Magyar Csapat10,08422

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 37 min 49 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:

https://foldit.fandom.com/wiki/Revisiting_puzzle/59:_TCR_Binding_Protein

(Googling "TCR binding protein Foldit" returns this page as well.)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons