puzzle picture
1690: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed

Summary

Name: 1690: Revisiting Puzzle 57: Beta-Neurotoxin
Status: Closed
Created: 06/23/2019
Points: 100
Expired: 07/01/2019 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,554100
2Anthropic Dreams10,50868
3Gargleblasters10,50444
4Marvin's bunch10,50027
5Go Science10,44416

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 01/19/2019
Groups: Go Science
Wiki
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons