puzzle picture
1687: Revisiting Puzzle 55: Scorpion Toxin
Status: Closed

Summary

Name: 1687: Revisiting Puzzle 55: Scorpion Toxin
Status: Closed
Created: 06/13/2019
Points: 100
Expired: 06/24/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,643100
2Beta Folders10,62173
3Anthropic Dreams10,55552
4Void Crushers10,50136
5L'Alliance Francophone10,41824

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 38 min 40 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons