puzzle picture
1682: Revisiting Puzzle 52: Bacterial Energy
Status: Closed

Summary

Name: 1682: Revisiting Puzzle 52: Bacterial Energy
Status: Closed
Created: 06/04/2019
Points: 100
Expired: 06/10/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,527100
2Beta Folders11,51470
3Anthropic Dreams11,48947
4Marvin's bunch11,43630
5Hun-Magyar Csapat11,41719

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 52 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
it's back (teria)

This is the first puzzle in the revisiting series, presented out of sequence this time for some reason.

https://foldit.fandom.com/wiki/Revisiting_puzzle/Bacteria_Energy

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons