![]() |
1677: Revisiting Puzzle 137: Rosetta Decoy
Status: Closed
|
Summary
Name: | 1677: Revisiting Puzzle 137: Rosetta Decoy |
---|---|
Status: | Closed |
Created: | 05/22/2019 |
Points: | 100 |
Expired: | 05/29/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/Rosetta_Decoy