puzzle picture
1676: Unsolved De-novo Freestyle 152: Symmetric Dimer
Status: Closed

Summary

Name: 1676: Unsolved De-novo Freestyle 152: Symmetric Dimer
Status: Closed
Created: 05/20/2019
Points: 100
Expired: 05/27/2019 - 23:00
Difficulty: Intermediate
Description: This is a follow-up to Puzzle 1673: De-novo Freestyle 152, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1673, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1673. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK
Categories: Overall, Prediction, Symmetry

Top Groups

RankGroupScorePoints
1Gargleblasters14,382100
2Beta Folders13,77070
3Anthropic Dreams13,75647
4Go Science13,45930
5L'Alliance Francophone13,42419

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 47 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Results
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons