puzzle picture
1674: Revisiting Puzzle 136: Cell Adhesion
Status: Closed

Summary

Name: 1674: Revisiting Puzzle 136: Cell Adhesion
Status: Closed
Created: 05/14/2019
Points: 100
Expired: 05/21/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1L'Alliance Francophone10,028100
2Gargleblasters9,93273
3Anthropic Dreams9,92452
4Beta Folders9,84336
5Hun-Magyar Csapat9,79824

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 11 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
see also:
vakobo's picture
User offline. Last seen 1 day 1 hour ago. Offline
Joined: 06/05/2008
Groups: Russian team
crash

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep's picture
User offline. Last seen 7 hours 15 min ago. Offline
Joined: 11/15/2012
Groups: None
Yes, please!

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo's picture
User offline. Last seen 1 day 1 hour ago. Offline
Joined: 06/05/2008
Groups: Russian team
Already shared

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons