puzzle picture
1671: Revisiting Puzzle 135: E. coli
Status: Closed

Summary

Name: 1671: Revisiting Puzzle 135: E. coli
Status: Closed
Created: 05/07/2019
Points: 100
Expired: 05/14/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,807100
2Go Science9,77479
3Anthropic Dreams9,71861
4L'Alliance Francophone9,69947
5Gargleblasters9,68935

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 7 hours 23 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
LociOiling's picture
User offline. Last seen 7 hours 23 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Images:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons