puzzle picture
1670: Unsolved De-novo Freestyle 150: Symmetric Dimer
Status: Closed

Summary

Name: 1670: Unsolved De-novo Freestyle 150: Symmetric Dimer
Status: Closed
Created: 05/06/2019
Points: 100
Expired: 05/13/2019 - 23:00
Difficulty: Intermediate
Description: This is a follow-up to Puzzle 1657: De-novo Freestyle 150, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1657, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1657. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
NEELRRRAEEMQKEFKDRWSKDPRDEQLRQMQQEIAKTLIEYQKRNADEEAWEAMTQLLRTLNDLHKKTY
Categories: Overall, Prediction, Symmetry

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,712100
2Contenders14,70673
3Beta Folders14,63452
4Go Science14,46736
5Marvin's bunch14,41724

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 06/06/2013
Groups: Gargleblasters
1657 results not showing

my prior puzzle solution isn't showing up...

LociOiling's picture
User offline. Last seen 19 min 45 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Images:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons