puzzle picture
1666: Revisiting Puzzle 126: Ethanolamine Utilization
Status: Closed

Summary

Name: 1666: Revisiting Puzzle 126: Ethanolamine Utilization
Status: Closed
Created: 04/23/2019
Points: 100
Expired: 04/30/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,905100
2Go Science10,73874
3FoldIt@Netherlands10,71254
4Anthropic Dreams10,63738
5Gargleblasters10,61427

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 36 min 53 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
cheers...
LociOiling's picture
User offline. Last seen 36 min 53 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Puzzle 1666 images
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons