puzzle picture
1663: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed

Summary

Name: 1663: Revisiting Puzzle 125: Ice Binding Protein
Status: Closed
Created: 04/16/2019
Points: 100
Expired: 04/23/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,169100
2Anthropic Dreams10,16976
3Void Crushers10,15856
4L'Alliance Francophone10,13641
5Gargleblasters10,13429

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 4 hours 56 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons