puzzle picture
1656: Revisiting Puzzle 117: Transport Mutant
Status: Closed

Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 23 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:

https://foldit.fandom.com/wiki/Revisiting_puzzle/Transport_Mutant

Looks like we received a few extra hours on this puzzle.

Also, there's a slight typo in the sequence as shown above, it should be:

mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcavgkdqfeevee
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons