puzzle picture
1656: Revisiting Puzzle 117: Transport Mutant
Status: Closed

Groups

RankGroupScorePoints
1Anthropic Dreams9,767100
2Beta Folders9,76477
3Hun-Magyar Csapat9,75558
4Contenders9,75043
5Gargleblasters9,74531
6Void Crushers9,74522
7Go Science9,74115
8Marvin's bunch9,73711
9L'Alliance Francophone9,7177
10Russian team9,7085
11Hold My Beer9,6343
12GENE 4339,5582
13FoldIt@Netherlands9,5031
14DW 20209,3531
15FoldIt@Poland9,3121
16I3L GANG9,3051
17freefolder9,2761
18DSN @ Home8,9431
19Italiani Al Lavoro8,9371
20SHELL8,4641


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 12 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:

https://foldit.fandom.com/wiki/Revisiting_puzzle/Transport_Mutant

Looks like we received a few extra hours on this puzzle.

Also, there's a slight typo in the sequence as shown above, it should be:

mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcavgkdqfeevee
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons