puzzle picture
1656: Revisiting Puzzle 117: Transport Mutant
Status: Closed

Summary

Name: 1656: Revisiting Puzzle 117: Transport Mutant
Status: Closed
Created: 04/01/2019
Points: 100
Expired: 04/08/2019 - 23:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
a MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,767100
2Beta Folders9,76477
3Hun-Magyar Csapat9,75558
4Contenders9,75043
5Gargleblasters9,74531

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 5 hours 14 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:

https://foldit.fandom.com/wiki/Revisiting_puzzle/Transport_Mutant

Looks like we received a few extra hours on this puzzle.

Also, there's a slight typo in the sequence as shown above, it should be:

mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcavgkdqfeevee
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons