![]() |
1654: Revisiting Puzzle 115: Exocyst
Status: Closed
|
Summary
Name: | 1654: Revisiting Puzzle 115: Exocyst |
---|---|
Status: | Closed |
Created: | 03/27/2019 |
Points: | 100 |
Expired: | 04/01/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
multiple reports on veteran chat, no client scoreboards on either solo or evo.