puzzle picture
1654: Revisiting Puzzle 115: Exocyst
Status: Closed

Summary

Name: 1654: Revisiting Puzzle 115: Exocyst
Status: Closed
Created: 03/27/2019
Points: 100
Expired: 04/01/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,132100
2Gargleblasters11,06076
3Go Science11,02056
4Anthropic Dreams11,01341
5L'Alliance Francophone10,98629

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

toshiue's picture
User offline. Last seen 1 week 5 days ago. Offline
Joined: 01/31/2016
Groups: Go Science
no client scoreboards

multiple reports on veteran chat, no client scoreboards on either solo or evo.

LociOiling's picture
User offline. Last seen 21 min 34 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons