puzzle picture
1652: Unsolved De-novo Freestyle 149: Symmetric Dimer
Status: Closed

Summary

Name: 1652: Unsolved De-novo Freestyle 149: Symmetric Dimer
Status: Closed
Created: 03/21/2019
Points: 100
Expired: 03/28/2019 - 23:00
Difficulty: Intermediate
Description: This is a follow-up to Puzzle 1649: De-novo Freestyle 149, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1649, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1649. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK
Categories: Overall, Prediction, Symmetry

Top Groups

RankGroupScorePoints
1Anthropic Dreams14,721100
2Go Science14,39771
3Gargleblasters14,32449
4Beta Folders14,25133
5Void Crushers14,19322

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 09/24/2012
Groups: Go Science
Amazing start on loading old puzzle

When loading an old 1649 puzzle, we get our points but the 2 dimers are merged. Then on first action, the points turn (logically) to -999999999. The game is then to try to assemble the 2 dimers.

NinjaGreg's picture
User offline. Last seen 3 weeks 23 hours ago. Offline
Joined: 05/21/2010
Groups: Go Science
Easy to get out of the merge ...

... just use the move tool before doing anything else, you can pull them apart intact.

frood66's picture
User offline. Last seen 8 hours 35 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
Just a shame that we were not

Just a shame that we were not given this puzzle info when we played the monomer.

Ir was pretty clear that it was a player design - but knowing it was a dimer might have helped.

bkoep's picture
User offline. Last seen 28 min 32 sec ago. Offline
Joined: 11/15/2012
Groups: None
Avoiding bias

I take this to mean that, "knowing it was a dimer might have helped [to predict it as a dimer]." I'm glad you brought this up, because it opens a discussion about the purpose of these puzzles, which may not be clear from the puzzle description.

In fact, we don't know this protein sequence actually forms a dimer—we only know that it was designed to form a dimer. The goal of these De-novo Freestyle puzzles is to look for decoy folds, or other ways the design sequence might fold up (i.e. ways that the design might fail). If Foldit players can find a high-scoring fold that is a monomer, that would suggest that the design is more likely to fold up as a monomer instead of the intended dimer.

For our purposes, we actually want to avoid biasing players towards the intended design. This is why we don't share the designed fold (or even the fact that it was designed as a dimer).

Joined: 06/06/2013
Groups: Gargleblasters
Fiendish does a great fold

clearly none of us managed to decoy this one. Well done

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons