puzzle picture
1651: Revisiting Puzzle 114: Black Mamba
Status: Closed

Summary

Name: 1651: Revisiting Puzzle 114: Black Mamba
Status: Closed
Created: 03/19/2019
Points: 100
Expired: 03/27/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,251100
2Anthropic Dreams11,18377
3Marvin's bunch11,12658
4L'Alliance Francophone11,11843
5Void Crushers11,10631

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
Groups: Beta Folders
See also:
Joined: 03/26/2019
Groups: None
Peer certificate issue

How do I play when the program gives an error message: Peer certificate cannot be authenticated with given CA certificates...

What's the protocol for solving this issue?

frood66's picture
User offline. Last seen 23 hours 58 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
would we be right in assuming

would we be right in assuming that the issues with in game and site scores will be sorted here shortly?

Or are we all wasting our time?

Joined: 03/05/2015
Groups: Gargleblasters
Scoreboard is indeed

still not working properly

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons