![]() |
1648: Revisiting Puzzle 113: White Birch
Status: Closed
|
Summary
Name: | 1648: Revisiting Puzzle 113: White Birch |
---|---|
Status: | Closed |
Created: | 03/13/2019 |
Points: | 100 |
Expired: | 03/20/2019 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/White_Birch
(almost forgot this time!)