puzzle picture
1642: Revisiting Puzzle 111: Mouse
Status: Closed

Summary

Name: 1642: Revisiting Puzzle 111: Mouse
Status: Closed
Created: 02/27/2019
Points: 100
Expired: 03/06/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,904100
2Contenders9,85079
3Go Science9,81961
4Hold My Beer9,81847
5Russian team9,81535

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 11 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
LociOiling's picture
User offline. Last seen 1 hour 11 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
Oops, try this instead:

There are *two* mouse revisiting puzzles. Thanks to actiasluna for spotting my error. The correct reference for this puzzle is:

https://foldit.fandom.com/wiki/Revisiting_puzzle/Mouse_-_puzzle_111

(edit: went with a more clickable name for the puzzle 111 page)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons