puzzle picture
1639: Revisiting Puzzle 110: Turkey
Status: Closed

Summary

Name: 1639: Revisiting Puzzle 110: Turkey
Status: Closed
Created: 02/20/2019
Points: 100
Expired: 02/27/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,549100
2Anthropic Dreams10,49478
3Go Science10,48360
4Gargleblasters10,38945
5Russian team10,34733

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 10 hours 39 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons