puzzle picture
1636: Revisiting Puzzle 109: Pumpkin
Status: Closed

Summary

Name: 1636: Revisiting Puzzle 109: Pumpkin
Status: Closed
Created: 02/12/2019
Points: 100
Expired: 02/20/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence:
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,253100
2Hun-Magyar Csapat9,22480
3Beta Folders9,18063
4Gargleblasters9,17049
5Go Science9,16037

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 20 hours 50 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons