puzzle picture
1624: Revisiting Puzzle 94: Mouse
Status: Closed

Summary

Name: 1624: Revisiting Puzzle 94: Mouse
Status: Closed
Created: 01/16/2019
Points: 100
Expired: 01/23/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,616100
2Beta Folders10,45974
3Void Crushers10,39254
4Marvin's bunch10,30838
5Gargleblasters10,30627

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
Groups: Beta Folders
See also:
Joined: 05/19/2009
Groups: Contenders
What is the point ?

Thank you for sharing Loci, but what is the point of revisiting these puzzles if the structure is known, previous solutions are shown and a script is given that you can load, enter a parameter in and start ?
I thought the purpose was to see if players can solve the structure all by themselves without prior knowledge ?

Joined: 01/19/2011
My understanding is that

My understanding is that these Revisiting puzzles are primarily intended to gauge how much Foldit's new tools have improved players' ability to generate more accurate solutions. Bridge Wiggle is definitely a useful tool, but it's not always the best way to assemble bridges IMO and I don't think it takes away from the goal of puzzles like 1624. In this case, I did not use Bridge Wiggle for my current high score on 1624 because doing so caused the cysteine residues to score poorly in my other attempts

frood66's picture
User offline. Last seen 11 hours 20 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
different views

I take on board both the comments above.

Then I have a nasty word for some - laziness.

I fear this is the way foldit has been going for a long time.

Sorry if that sounds harsh.

Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons