puzzle picture
1620: Revisiting Puzzle 93: Spider Toxin
Status: Closed

Summary

Name: 1620: Revisiting Puzzle 93: Spider Toxin
Status: Closed
Created: 01/08/2019
Points: 100
Expired: 01/16/2019 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Void Crushers9,910100
2Go Science9,89276
3Anthropic Dreams9,87356
4Beta Folders9,86641
5Contenders9,77829

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1dcrwheeler 90 12  9,996100
2Timo van&n... 90 7 Void Crushers9,91098
3ZeroLeak7IRC 76 68 Go Science9,89295
4fiendish_ghoul 90 5  9,88592
5johnmitch 90 8  9,88089


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 29 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons