puzzle picture
1615: Unsolved De-novo Freestyle 140
Status: Closed

Summary

Name: 1615: Unsolved De-novo Freestyle 140
Status: Closed
Created: 12/27/2018
Points: 0
Expired: 01/03/2019 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle was posted erroneously with the wrong setup. The puzzle was closed early, and has been reposted with the correct setup as Puzzle 1615b.

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:
PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD
Categories:

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,1910
2Go Science9,0050
3L'Alliance Francophone8,9130
4Dutch Power Cows8,2630
5Beta Folders7,6750

Top Soloists



Need this puzzle? Log in to download.  

Comments

Batz's picture
User offline. Last seen 2 weeks 1 day ago. Offline
Joined: 02/16/2012
Groups: Go Science
correct sequence

ETVTSCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCTGTWVPIGLAIPENAAAH

Susume's picture
User offline. Last seen 1 day 6 hours ago. Offline
Joined: 10/02/2011
This is the same as 1614

Looks like you accidentally re-posted puzzle 1614 (revisiting) instead of the denovo.

bkoep's picture
User offline. Last seen 2 hours 12 sec ago. Offline
Joined: 11/15/2012
Groups: None
You're right!

Sorry for the mix up! This puzzle has been closed. See the correct Puzzle 1615 here.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons