puzzle picture
1601: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed

Summary

Name: 1601: Revisiting Puzzle 87: Zinc Binding Protein
Status: Closed
Created: 11/19/2018
Points: 100
Expired: 11/28/2018 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,093100
2Beta Folders9,04177
3Contenders9,03358
4Marvin's bunch9,02443
5Go Science9,01731

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Waya 26 47 Anthropic Dreams9,086100
2johnmitch 80 7  9,05297
3Aubade01 80 34  9,04294
4retiredmichael 11 1 Beta Folders9,04192
5crpainter 80 11 Contenders9,03389


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 29 min 45 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons