puzzle picture
1598: Cryo-EM Freestyle with Density
Status: Closed

Summary

Name: 1598: Cryo-EM Freestyle with Density
Status: Closed
Created: 11/12/2018
Points: 100
Expired: 11/27/2018 - 14:00
Difficulty: Expert
Description: This protein is another part of the same protein complex with multiple subunits from Puzzle 1554 and Puzzle 1588, which has been the target of cryo-EM experiments. We are giving you an extended chain to start with, so good luck!
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams18,575100
2Beta Folders18,53076
3Go Science18,37756
4Marvin's bunch18,30641
5Gargleblasters15,92629

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

beta_helix's picture
User offline. Last seen 2 days 20 hours ago. Offline
Joined: 05/09/2008
Groups: None
Sequence:

MSTPAVSHRFLVNFLFNNIPNPFDIAFQRISGLSRTLEVSQHREGGENVRNLWLAEQVNHGSL
VLERGVMNASPLTLQFDRVLRRESTQWANVVIMLLNELSLPVTTWTLSHALPVRWQMGDLDAG
SNQVLINTLELRYQDMRMLGVKL

Joined: 10/30/2012
Groups: Beta Folders
more time, maybe 6 months

more time, maybe 6 months

Joined: 09/24/2012
Groups: Go Science
More time

2 weeks

Joined: 10/30/2012
Groups: Beta Folders
at least 2 weeks

at least 2 weeks

beta_helix's picture
User offline. Last seen 2 days 20 hours ago. Offline
Joined: 05/09/2008
Groups: None
2 weeks it is!

Thank you both for the feedback, we've extended this one by another week.
Sadly we won't be able to extend it for 6 months, though! :-)

frood66's picture
User offline. Last seen 47 min 25 sec ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
this needs no more time I

this needs no more time I have spent just 10 hours on this....no more time is needed.

frood66's picture
User offline. Last seen 47 min 25 sec ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
2 weeks for a very clear ED

2 weeks for a very clear ED is a joke - it only plays to those that have big machines and rely on script work. If I can play this with handwork and have no issues - why are those with big machines given such a ridiculous amount of time to catch up?

Joined: 10/30/2012
Groups: Beta Folders
i have 2 hours a day to work

i have 2 hours a day to work on foldit, 10 hours the first day---not possible

frood66's picture
User offline. Last seen 47 min 25 sec ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
but U can run a fast machine

but U can run a fast machine 24 hrs a day on multiple puzzles regardless - I cannot...be fair michael. U know what I mean.

Joined: 10/30/2012
Groups: Beta Folders
ed is about hand work

there isn't a script for electron density, right now i have 1/2 an hour before I have to pick up my granddaughter at school. then its cook dinner for the family. I have a bit of time each morning after I drop her off and then its laundry, shopping and the garden etc.

I agree with you on revisits, and most of the other puzzles. just not ed

jeff101's picture
User offline. Last seen 16 hours 27 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Secondary Structure:

I think this puzzle starts with all loops as
its secondary structure. Is that intentional?

Joined: 09/24/2012
Groups: Go Science
May be prediction is not reliable enough for ED

However, PSIPRED prediction (bellow) is quite useful to help to fit into the density somewhere (but the density gives a quite different pattern after all)

Joined: 09/24/2012
Groups: Go Science
PSIPRED secundary structure prediction

LLLLLLLLEEEEEEELLLLLLLLEEEEEEEELLLEEEEEEEEEELLLLLEEEELLLLLLLLLEEEEEEELLLLHHHHHHHHHHLLLLEEEEEEEEEEELLLLLEEEEEEELLEEEEEEEELLLLLLLLEEEEEEEEEEEELEEEEEEEL

copy-paste it in note 19 then run:
https://fold.it/portal/recipe/49556

(and run this recipe every time you want to recover it)

Source for prediction (it takes 30 minutes):
http://bioinf.cs.ucl.ac.uk/psipred/

Vinara's picture
User offline. Last seen 1 day 11 hours ago. Offline
Joined: 12/21/2013
Groups: None
Thank you. Quick question for

Thank you. Quick question for Foldit for Dummies: Where do I find note 19?

jeff101's picture
User offline. Last seen 16 hours 27 min ago. Offline
Joined: 04/20/2012
Groups: Go Science
Where is Note 19?

In Puzzle 1598, if you are in the Original Interface using
the Rainbow color scheme, you can find Note 19 by Tabbing
on the blue end of the protein. A window called "Segment
Information" will appear for the segment you Tabbed on.
You can then use the left or right arrow key to move to
the "Segment Information" window for Isoleucine 19. At the
bottom of this window is a section called "Notes". You can
paste the desired secondary structure (listed above) in the
"Notes" section. The little trash can next to the "Notes"
section clears this section's contents.

Vinara's picture
User offline. Last seen 1 day 11 hours ago. Offline
Joined: 12/21/2013
Groups: None
Thank you. :)

Thank you. :)

toshiue's picture
User offline. Last seen 8 hours 59 min ago. Offline
Joined: 01/31/2016
Groups: Go Science
Note 19

...or you can use SS Edit 1.2 (recipe 102273)

Joined: 09/24/2012
Groups: Go Science
Note 19
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons