puzzle picture
1596: Revisiting Puzzle 85: Cell Adhesion Protein
Status: Closed

Summary

Name: 1596: Revisiting Puzzle 85: Cell Adhesion Protein
Status: Closed
Created: 11/06/2018
Points: 100
Expired: 11/13/2018 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,902100
2Contenders9,83270
3Beta Folders9,80247
4L'Alliance Francophone9,78030
5Gargleblasters9,77719

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 17 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons