puzzle picture
1596: Revisiting Puzzle 85: Cell Adhesion Protein
Status: Closed

Summary

Name: 1596: Revisiting Puzzle 85: Cell Adhesion Protein
Status: Closed
Created: 11/06/2018
Points: 100
Expired: 11/13/2018 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,902100
2Contenders9,83270
3Beta Folders9,80247
4L'Alliance Francophone9,78030
5Gargleblasters9,77719

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 56 min 46 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons