puzzle picture
1593: Revisiting Puzzle 84: Giant Anemone
Status: Closed

Summary

Name: 1593: Revisiting Puzzle 84: Giant Anemone
Status: Closed
Created: 10/29/2018
Points: 100
Expired: 11/05/2018 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,885100
2Go Science9,78771
3Gargleblasters9,76449
4Beta Folders9,74033
5Void Crushers9,73922

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1tyler0911 41 14 Anthropic Dreams9,881100
2Aubade01 76 40  9,85497
3fiendish_ghoul 76 5  9,84394
4johnmitch 76 7  9,83091
5Bruno Kestemont 4 4 Go Science9,78288


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 56 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons