puzzle picture
1591: Revisiting Puzzle 83: Cardiotoxin
Status: Closed

Summary

Name: 1591: Revisiting Puzzle 83: Cardiotoxin
Status: Closed
Created: 10/19/2018
Points: 100
Expired: 10/26/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,364100
2Beta Folders10,32570
3Void Crushers10,17247
4Marvin's bunch10,12930
5Anthropic Dreams10,11719

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 46 min 5 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons