puzzle picture
1588: 221-residue Cryo-EM Multi-Start with Density
Status: Closed

Soloists



Need this puzzle? Log in to download.  

Comments

beta_helix's picture
User offline. Last seen 20 hours 33 min ago. Offline
Joined: 05/09/2008
Groups: None
Saves from 1554

NOTE: If you did not manually save a solution in Puzzle 1554, you can go back to 1554, manually save it, and the solution should appear in your manual saves for this puzzle.

Sequence:
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

frood66's picture
User offline. Last seen 3 hours 33 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
puzzle speed/stability

I did not expect to be able to play this puzzle.

I don't know what has been done - but it runs fine. It will never be the fastest running (given it's size and being ED)

Whatever has been done to make this playable - congrats to FC

Joined: 09/24/2012
Groups: Go Science
Great given delay

It's great that we had a plenty of time to play this one. I won't even have enough time to end it but I suppose it's ok for you scientists to evaluate our results afterwards.

Joined: 02/20/2018
Groups: Go Science
That was a lot of fun

That was a lot of fun watching go science pass it back and forth and back and forth. 10 of the top 11 scores! Great work.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons