puzzle picture
1588: 221-residue Cryo-EM Multi-Start with Density
Status: Closed

Summary

Name: 1588: 221-residue Cryo-EM Multi-Start with Density
Status: Closed
Created: 10/16/2018
Points: 100
Expired: 11/03/2018 - 08:00
Difficulty: Expert
Description: This is a repost of Puzzle 1579, now with electron density! Load in your Puzzle 1579 solutions and see if you can improve them to fit the density! We are giving you the same 5 server predictions as starting points, and over TWO WEEKS to work on this difficult target. Read the blogpost for more details.
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science22,359100
2Anthropic Dreams22,29180
3Beta Folders22,26763
4Marvin's bunch21,98549
5Contenders17,74637

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

beta_helix's picture
User offline. Last seen 1 day 3 hours ago. Offline
Joined: 05/09/2008
Groups: None
Saves from 1554

NOTE: If you did not manually save a solution in Puzzle 1554, you can go back to 1554, manually save it, and the solution should appear in your manual saves for this puzzle.

Sequence:
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

frood66's picture
User offline. Last seen 5 hours 52 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
puzzle speed/stability

I did not expect to be able to play this puzzle.

I don't know what has been done - but it runs fine. It will never be the fastest running (given it's size and being ED)

Whatever has been done to make this playable - congrats to FC

Joined: 09/24/2012
Groups: Go Science
Great given delay

It's great that we had a plenty of time to play this one. I won't even have enough time to end it but I suppose it's ok for you scientists to evaluate our results afterwards.

Joined: 02/20/2018
Groups: Go Science
That was a lot of fun

That was a lot of fun watching go science pass it back and forth and back and forth. 10 of the top 11 scores! Great work.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons