puzzle picture
1579: 221-residue Cryo-EM Multi-Start Puzzle
Status: Closed

Summary

Name: 1579: 221-residue Cryo-EM Multi-Start Puzzle
Status: Closed
Created: 10/01/2018
Points: 100
Expired: 10/09/2018 - 10:00
Difficulty: Intermediate
Description: This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders12,452100
2Anthropic Dreams12,42971
3Contenders12,02849
4Go Science11,88433
5L'Alliance Francophone11,73022

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 05/19/2009
Groups: Contenders
Not showing

This puzzle is not showing up in the puzzle download menu. 20180829-6ed3ad0d20-win_x86

beta_helix's picture
User offline. Last seen 11 hours 48 min ago. Offline
Joined: 05/09/2008
Groups: None
You able to see it now, BP?

Many people have been able to play this one, are you still getting that error?

frood66's picture
User offline. Last seen 13 hours 13 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
Sequence

where is the sequence - not shown on this page (which is de rigour these days)

Susume's picture
User offline. Last seen 4 hours 31 min ago. Offline
Joined: 10/02/2011
Sequence

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

beta_helix's picture
User offline. Last seen 11 hours 48 min ago. Offline
Joined: 05/09/2008
Groups: None
My apologies for forgetting the sequence

Thank you Susume for posting it so quickly!

Joined: 05/19/2009
Groups: Contenders
I can now load it, thank you !

I can now load it, thank you !

beta_helix's picture
User offline. Last seen 11 hours 48 min ago. Offline
Joined: 05/09/2008
Groups: None
Yay!

I believe that sometimes it posts to the website but takes longer to sync up with the client.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons