puzzle picture
1579: 221-residue Cryo-EM Multi-Start Puzzle
Status: Closed

Summary

Name: 1579: 221-residue Cryo-EM Multi-Start Puzzle
Status: Closed
Created: 10/01/2018
Points: 100
Expired: 10/09/2018 - 10:00
Difficulty: Intermediate
Description: This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders12,452100
2Anthropic Dreams12,42971
3Contenders12,02849
4Go Science11,88433
5L'Alliance Francophone11,73022

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 05/19/2009
Groups: Contenders
Not showing

This puzzle is not showing up in the puzzle download menu. 20180829-6ed3ad0d20-win_x86

beta_helix's picture
User offline. Last seen 1 hour 47 min ago. Offline
Joined: 05/09/2008
Groups: None
You able to see it now, BP?

Many people have been able to play this one, are you still getting that error?

frood66's picture
User offline. Last seen 3 hours 23 min ago. Offline
Joined: 09/20/2011
Groups: Marvin's bunch
Sequence

where is the sequence - not shown on this page (which is de rigour these days)

Susume's picture
User offline. Last seen 2 hours 11 min ago. Offline
Joined: 10/02/2011
Sequence

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

beta_helix's picture
User offline. Last seen 1 hour 47 min ago. Offline
Joined: 05/09/2008
Groups: None
My apologies for forgetting the sequence

Thank you Susume for posting it so quickly!

Joined: 05/19/2009
Groups: Contenders
I can now load it, thank you !

I can now load it, thank you !

beta_helix's picture
User offline. Last seen 1 hour 47 min ago. Offline
Joined: 05/09/2008
Groups: None
Yay!

I believe that sometimes it posts to the website but takes longer to sync up with the client.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons