puzzle picture
1575: Revisiting Puzzle 80: Calcium Channel Blocker
Status: Closed

Summary

Name: 1575: Revisiting Puzzle 80: Calcium Channel Blocker
Status: Closed
Created: 09/18/2018
Points: 100
Expired: 09/26/2018 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Marvin's bunch10,101100
2Contenders10,09063
3Beta Folders10,08237
4Go Science10,03121
5Anthropic Dreams9,99811

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1hpaege 78 26  10,112100
2Bletchley Park 24 17 Contenders10,09097
3retiredmichael 12 1 Beta Folders10,07994
4smilingone 10 42 Beta Folders10,06490
5fiendish_ghoul 78 5  10,06087


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 8 hours 50 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
see also...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons