puzzle picture
1562: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed

Summary

Name: 1562: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed
Created: 08/14/2018
Points: 100
Expired: 08/22/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
21E?????! Heureka!9,1941

Top Evolvers

RankPlayerGroupScorePoints
21JellyJump 105 5613 Beta Folders9,81845

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 2 hours 32 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Other Games: Mozak
Search
Only search fold.it
Recommend Foldit
User login
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons