puzzle picture
1559: Revisiting Puzzle 74: Platypus Venom
Status: Closed

Summary

Name: 1559: Revisiting Puzzle 74: Platypus Venom
Status: Closed
Created: 08/06/2018
Points: 100
Expired: 08/15/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,991100
2Beta Folders9,77465
3Anthropic Dreams9,70241
4Gargleblasters9,68124
5Marvin's bunch9,66614

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 9 hours 8 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons