Summary

Name:	1556: Revisiting Puzzle 73: Polycystein
Status:	Closed
Created:	08/01/2018
Points:	100
Expired:	08/08/2018 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Beta Folders	10,617	100
2	Anthropic Dreams	10,473	68
3	Go Science	10,454	44
4	Gargleblasters	10,447	27
5	Marvin's bunch	10,438	16

Rank	Player	Group	Score	Points
1	LociOiling 7 2	Beta Folders	10,617	100
2	smilingone 172 15968	Beta Folders	10,606	97
3	retiredmichael 68 106	Beta Folders	10,597	93
4	reefyrob 141 9751	Beta Folders	10,548	89
5	Galaxie 3 5	Anthropic Dreams	10,473	86

Rank	Player	Group	Score	Points
1	reefyrob 141 9751	Beta Folders	10,614	100
2	Aubade01 172 104		10,610	97
3	bertro 172 86	Beta Folders	10,596	93
4	LociOiling 7 2	Beta Folders	10,590	89
5	retiredmichael 68 106	Beta Folders	10,569	86

Need this puzzle? Log in to download.

Wed, 08/01/2018 - 22:54

Offline

Joined: 12/27/2012

Groups: Beta Folders

Thu, 08/02/2018 - 19:27

Offline

Joined: 09/22/2017

Groups: Beta Folders

I Found A Spelling Mistake

The accepted name for this protien is "polycystin 1" not polycystein

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Recommend Foldit


	User login Username: * Password: * Create new account Request new password


	Topics
	CoVid-19 age related severity Create a new experimental script The Hypotheses from Investigating Proteins concerning Oxygen online only Scripps Study: D614G Mutation Allows Coronavirus to Infect More Cells


	Top New Users Moosenger Sforiu kosmo1 BNet felimare