Summary

Name:	1556: Revisiting Puzzle 73: Polycystein
Status:	Closed
Created:	08/01/2018
Points:	100
Expired:	08/08/2018 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Beta Folders	10,617	100
2	Anthropic Dreams	10,473	68
3	Go Science	10,454	44
4	Gargleblasters	10,447	27
5	Marvin's bunch	10,438	16

Rank	Player	Group	Score	Points
1	LociOiling 2 1	Beta Folders	10,617	100
2	smilingone 49 288	Beta Folders	10,606	97
3	retiredmichael 16 4	Beta Folders	10,597	93
4	reefyrob 76 740	Beta Folders	10,548	89
5	Galaxie 1 2	Anthropic Dreams	10,473	86

Rank	Player	Group	Score	Points
1	reefyrob 76 740	Beta Folders	10,614	100
2	Aubade01 76 70		10,610	97
3	bertro 76 368	Beta Folders	10,596	93
4	LociOiling 2 1	Beta Folders	10,590	89
5	retiredmichael 16 4	Beta Folders	10,569	86

Need this puzzle? Log in to download.

Wed, 08/01/2018 - 22:54

Offline

Joined: 12/27/2012

Groups: Beta Folders

Thu, 08/02/2018 - 19:27

Offline

Joined: 09/22/2017

Groups: Beta Folders

I Found A Spelling Mistake

The accepted name for this protien is "polycystin 1" not polycystein

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics


	Top New Users mardenfm RichardKL brianpark888 jb3 sydlg19