puzzle picture
1556: Revisiting Puzzle 73: Polycystein
Status: Closed

Summary

Name: 1556: Revisiting Puzzle 73: Polycystein
Status: Closed
Created: 08/01/2018
Points: 100
Expired: 08/08/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,617100
2Anthropic Dreams10,47368
3Go Science10,45444
4Gargleblasters10,44727
5Marvin's bunch10,43816

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 17 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
see also...
Joined: 09/22/2017
Groups: Beta Folders
I Found A Spelling Mistake

The accepted name for this protien is "polycystin 1" not polycystein

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons