Summary

Name:	1556: Revisiting Puzzle 73: Polycystein
Status:	Closed
Created:	08/01/2018
Points:	100
Expired:	08/08/2018 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Beta Folders	10,617	100
2	Anthropic Dreams	10,473	68
3	Go Science	10,454	44
4	Gargleblasters	10,447	27
5	Marvin's bunch	10,438	16

Rank	Player	Group	Score	Points
1	LociOiling 8 2	Beta Folders	10,617	100
2	smilingone 93 2664	Beta Folders	10,606	97
3	retiredmichael 93 1654	Beta Folders	10,597	93
4	reefyrob 93 2664	Beta Folders	10,548	89
5	Galaxie 4 9	Anthropic Dreams	10,473	86

Rank	Player	Group	Score	Points
1	reefyrob 93 2664	Beta Folders	10,614	100
2	Aubade01 93 68		10,610	97
3	bertro 93 2664	Beta Folders	10,596	93
4	LociOiling 8 2	Beta Folders	10,590	89
5	retiredmichael 93 1654	Beta Folders	10,569	86

Need this puzzle? Log in to download.

Wed, 08/01/2018 - 22:54

Offline

Joined: 12/27/2012

Groups: Beta Folders

Thu, 08/02/2018 - 19:27

Offline

Joined: 09/22/2017

Groups: Beta Folders

I Found A Spelling Mistake

The accepted name for this protien is "polycystin 1" not polycystein


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)


	Click here to read Foldit's statement on the Black Lives Matter movement.

Recommend Foldit


	Topics
	The spammers have returned! How to Foldit What is the best computer for folding ? Foldit in the News and Foldit Presentations Foldit Newsletters


	Top New Users ManuelGK Zymkaz Rustytincan EnsaladaMixta johnpwykes