puzzle picture

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Status: Closed

Summary

Name:	1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus
Status:	Closed
Created:	07/19/2018
Points:	100
Expired:	07/27/2018 - 04:00
Difficulty:	Intermediate
Description:	This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else! Sequence: KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	10,626	100
2	Beta Folders	10,513	65
3	Anthropic Dreams	10,501	41
4	Void Crushers	10,395	24
5	Marvin's bunch	10,294	14

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	sciencewalker 20 123	Go Science	10,597	100
2	Bruno Kestemont 3 1	Go Science	10,595	96
3	Hollinas 37 855	Go Science	10,592	92
4	mirp 1 5	Go Science	10,592	88
5	ZeroLeak7 38 31	Go Science	10,591	84

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	ZeroLeak7 38 31	Go Science	10,626	100
2	bertro 83 2324	Beta Folders	10,505	96
3	retiredmichael 83 2324	Beta Folders	10,502	92
4	tyler0911 83 2324	Anthropic Dreams	10,486	88
5	reefyrob 83 2324	Beta Folders	10,476	84

Show all >

Need this puzzle? Log in to download.

Comments

Sat, 07/21/2018 - 23:41

#1

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Beta Folders

See also...

https://foldit.wikia.com/wiki/Revisiting_puzzle/Bos_taurus

Don't have a cow, man!


	User login Username: * Password: * Create new account Request new password

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Social Media


	Search Only search fold.it


	Click here to read Foldit's statement on the Black Lives Matter movement.


	Other Games: Mozak

Recommend Foldit


	Topics
	Game Researchers Need Your Help Office Hours Foldit Newsletters Lecture by David Baker (open to all) Happy few Gold players in History


	Top New Users mifan Matroch 80580729 hyunjoo Jibster

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons