![]() |
1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus
Status: Closed
|
Summary
Name: | 1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus |
---|---|
Status: | Closed |
Created: | 07/19/2018 |
Points: | 100 |
Expired: | 07/27/2018 - 04:00 |
Difficulty: | Intermediate |
Description: | This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.wikia.com/wiki/Revisiting_puzzle/Bos_taurus
Don't have a cow, man!