puzzle picture
1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus
Status: Closed

Summary

Name: 1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus
Status: Closed
Created: 07/19/2018
Points: 100
Expired: 07/27/2018 - 04:00
Difficulty: Intermediate
Description: This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!

Sequence:
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,626100
2Beta Folders10,51365
3Anthropic Dreams10,50141
4Void Crushers10,39524
5Marvin's bunch10,29414

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 11 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons