puzzle picture

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Status: Closed

Summary

Name:	1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus
Status:	Closed
Created:	07/19/2018
Points:	100
Expired:	07/27/2018 - 04:00
Difficulty:	Intermediate
Description:	This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else! Sequence: KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Go Science	10,626	100
2	Beta Folders	10,513	65
3	Anthropic Dreams	10,501	41
4	Void Crushers	10,395	24
5	Marvin's bunch	10,294	14

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	sciencewalker 70 209	Go Science	10,597	100
2	Bruno Kestemont 2 3	Go Science	10,595	96
3	Hollinas 112 6293	Go Science	10,592	92
4	mirp 1 2	Go Science	10,592	88
5	ZeroLeak7 35 7	Go Science	10,591	84

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	ZeroLeak7 35 7	Go Science	10,626	100
2	bertro 152 115	Beta Folders	10,505	96
3	retiredmichael 103 254	Beta Folders	10,502	92
4	tyler0911 152 13858	Anthropic Dreams	10,486	88
5	reefyrob 152 13858	Beta Folders	10,476	84

Show all >

Need this puzzle? Log in to download.

Comments

Sat, 07/21/2018 - 23:41

#1

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Beta Folders

See also...

https://foldit.wikia.com/wiki/Revisiting_puzzle/Bos_taurus

Don't have a cow, man!

Download links:


Windows (7/8/10)	OSX (10.12 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Other Games: Mozak


	Search Only search fold.it

Recommend Foldit


	User login Username: * Password: * Create new account Request new password


	Topics
	Foldit Newsletters A G-quadruplex-binding macrodomain within the “SARS-unique domain” is essential for the activity of the SARS-coronavirus replica Two-amino acids change in the nsp4 of SARS coronavirus abolishes viral replication Centre d’information sur le nouveau coronavirus Good late game recipes?


	Top New Users cmowinckel essemiyagi ArmandGV equilibria HelixHealer91

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons