puzzle picture
1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin
Status: Closed

Summary

Name: 1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin
Status: Closed
Created: 07/16/2018
Points: 100
Expired: 07/23/2018 - 17:00
Difficulty: Intermediate
Description: This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!

Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,888100
2Marvin's bunch10,76563
3Go Science10,73737
4Anthropic Dreams10,63821
5Void Crushers10,63411

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons