puzzle picture
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein
Status: Active

Summary

Name: 1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein
Status: Active
Created: 07/12/2018
Points: 100
Expires: 07/20/2018 - 04:00
Difficulty: Intermediate
Description: This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!

Sequence:
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Void Crushers10,998
2Beta Folders10,992
3Anthropic Dreams10,950
4Go Science10,946
5L'Alliance Francophone10,943

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 50 min 44 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons