|
|
|
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein
Status: Closed
|
Summary
| Name: |
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein |
| Status: |
Closed |
| Created: |
07/12/2018 |
| Points: |
100 |
| Expired: |
07/20/2018 - 04:00 |
| Difficulty: |
Intermediate |
| Description: |
This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
|
| Categories: | Overall, Prediction |
|---|
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
|
|
| | |
| | |
| | |
| | |
| Soloists | |
| Evolvers | |
| Groups | |
| Topics | |
|
|
| bertro 50 15 | 1597: Aflatoxin...12b | 13,274 | | bertro 50 15 | 1598: Cryo-EM F...ity | 18,196 | | retiredmichael 8 1 | 1599: Revisitin...ode | 11,008 | | johnmitch 76 7 | 1600: Symmetric...ign | 20,058 | | Biosphere 76 227 | Beginner Puzzle...ign | 10,281 | | Kaputnik 76 207 | Beginner Puzzle...yle | 9,117 | | Wojcimierz 76 291 | Beginner Puzzle...zle | 9,272 | | Tlaloc 76 336 | Beginner Puzzle...nis | 9,768 | | Wojcimierz 76 291 | Beginner Puzzle...ity | 15,799 | | u.w. 76 86 | Beginner Puzzle...ign | 13,526 |
|
|
| | |
|
| bertro 50 15 | 1597: Aflatoxin...12b | 13,274 | | bertro 50 15 | 1598: Cryo-EM F...ity | 18,196 | | retiredmichael 8 1 | 1599: Revisitin...ode | 11,008 | | johnmitch 76 7 | 1600: Symmetric...ign | 20,058 | | Biosphere 76 227 | Beginner Puzzle...ign | 10,281 | | Kaputnik 76 207 | Beginner Puzzle...yle | 9,117 | | Wojcimierz 76 291 | Beginner Puzzle...zle | 9,272 | | Tlaloc 76 336 | Beginner Puzzle...nis | 9,768 | | Wojcimierz 76 291 | Beginner Puzzle...ity | 15,799 | | u.w. 76 86 | Beginner Puzzle...ign | 13,526 | |
| Beta Folders | 1597: Aflatoxin...12b | 13,392 | | Beta Folders | 1598: Cryo-EM F...ity | 18,196 | | Beta Folders | 1599: Revisitin...ode | 11,009 | | Gargleblasters | 1600: Symmetric...ign | 19,550 | | Czech National Team | Beginner Puzzle...ign | 10,281 | | Gluconeogenesis | Beginner Puzzle...yle | 9,107 | | Marvin's bunch | Beginner Puzzle...zle | 9,214 | | Mojo Risin' | Beginner Puzzle...nis | 9,768 | | Czech National Team | Beginner Puzzle...ity | 15,729 | | Go Science | Beginner Puzzle...ign | 12,714 | |
|
|
https://foldit.wikia.com/wiki/Revisiting_puzzle/Spinach_Protein
Oh, Popeye!