|
|
|
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein
Status: Closed
|
Summary
| Name: |
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein |
| Status: |
Closed |
| Created: |
07/12/2018 |
| Points: |
100 |
| Expired: |
07/20/2018 - 04:00 |
| Difficulty: |
Intermediate |
| Description: |
This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
|
| Categories: | Overall, Prediction |
|---|
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
|
|
| | |
| | |
| | |
| | |
| Soloists | |
| Evolvers | |
| Groups | |
| Topics | |
|
|
| NinjaGreg 23 23 | 1712: Revisitin...xin | 11,734 | | Waya 6 8 | 1713: IL-7R Bin...d 5 | 11,589 | | silent gene 7 6 | 1714: Symmetric...ues | 22,978 | | jobo0502 76 24 | 1715: IL-7R Bin...d 6 | 11,503 | | ComputerMage 76 618 | Beginner Puzzle...ign | 10,358 | | kevin ever... 76 546 | Beginner Puzzle...yle | 8,219 | | Dj-P 76 281 | Beginner Puzzle...zle | 9,082 | | Dj-P 76 281 | Beginner Puzzle...nis | 9,958 | | Franco1947 76 1437 | Beginner Puzzle...ity | 15,963 | | Merf 76 54 | Beginner Puzzle...ign | 13,671 |
|
|
| | |
|
| NinjaGreg 23 23 | 1712: Revisitin...xin | 11,734 | | Waya 6 8 | 1713: IL-7R Bin...d 5 | 11,589 | | silent gene 7 6 | 1714: Symmetric...ues | 22,978 | | jobo0502 76 24 | 1715: IL-7R Bin...d 6 | 11,503 | | ComputerMage 76 618 | Beginner Puzzle...ign | 10,358 | | kevin ever... 76 546 | Beginner Puzzle...yle | 8,219 | | Dj-P 76 281 | Beginner Puzzle...zle | 9,082 | | Dj-P 76 281 | Beginner Puzzle...nis | 9,958 | | Franco1947 76 1437 | Beginner Puzzle...ity | 15,963 | | Merf 76 54 | Beginner Puzzle...ign | 13,671 | |
| Go Science | 1712: Revisitin...xin | 11,734 | | Anthropic Dreams | 1713: IL-7R Bin...d 5 | 11,592 | | Go Science | 1714: Symmetric...ues | 22,978 | | L'Alliance Fran...one | 1715: IL-7R Bin...d 6 | 11,503 | | Russian team | Beginner Puzzle...ign | 10,358 | | Go Science | Beginner Puzzle...yle | 6,713 | | Go Science | Beginner Puzzle...zle | 9,082 | | Go Science | Beginner Puzzle...nis | 9,958 | | Go Science | Beginner Puzzle...ity | 15,578 | | Go Science | Beginner Puzzle...ign | 13,109 | |
|
|
https://foldit.wikia.com/wiki/Revisiting_puzzle/Spinach_Protein
Oh, Popeye!