puzzle picture

1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein

Status: Closed

Summary

Name:	1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein
Status:	Closed
Created:	07/12/2018
Points:	100
Expired:	07/20/2018 - 04:00
Difficulty:	Intermediate
Description:	This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else! Sequence: AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Anthropic Dreams	11,031	100
2	Void Crushers	11,008	70
3	Go Science	11,003	47
4	Beta Folders	10,992	30
5	L'Alliance Francophone	10,943	19

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	Galaxie 2 2	Anthropic Dreams	11,023	100
2	robgee 5 14	Anthropic Dreams	11,008	96
3	Bruno Kestemont 4 4	Go Science	11,000	92
4	toshiue 3 57	Go Science	10,995	88
5	reefyrob 6 15	Beta Folders	10,992	84

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	robgee 5 14	Anthropic Dreams	11,031	100
2	Timo van&n... 74 5	Void Crushers	11,008	96
3	Bruno Kestemont 4 4	Go Science	11,003	92
4	fiendish_ghoul 74 8		11,002	88
5	bertro 35 6	Beta Folders	10,992	84

Show all >

Need this puzzle? Log in to download.

Comments

Fri, 07/13/2018 - 04:02

#1

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Beta Folders

See also:

https://foldit.wikia.com/wiki/Revisiting_puzzle/Spinach_Protein

Oh, Popeye!

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Search Only search fold.it

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics

Player	Puzzle	Score
vakobo 74 460	1573: HIV Prote...d 3	20,267
johnmitch 74 9	1574: Extra Sma...ign	12,135
Technetium 74 921	Beginner Puzzle...ign	10,343
Technetium 74 921	Beginner Puzzle...yle	9,079
KnaveErrant 74 211	Beginner Puzzle...zle	9,001
hansvandenhof 74 217	Beginner Puzzle...nis	10,618
Technetium 74 921	Beginner Puzzle...ity	16,021
jausmh 24 40	Beginner Puzzle...ign	14,164
actiasluna 21 11	Partition Puzzl...una	11,742
silent gene 74 79	Partition Puzzl...r29	10,074
robgee 5 14	Partition Puzzl...oul	10,764
jausmh 24 40	Partition Puzzl...d66	10,732
anthion 69 68	Partition Puzzl...xie	11,790
robgee 5 14	Partition Puzzl...137	10,120
isaksson 12 24	Partition Puzzl...tch	10,433
Glen B 74 23	Partition Puzzl...ing	11,455
guineapig 74 43	Partition Puzzl...170	9,640
Galaxie 2 2	Partition Puzzl...ard	10,020
isaksson 12 24	Partition Puzzl...ran	11,712
Galaxie 2 2	Partition Puzzl...ant	9,845
isaksson 12 24	Partition Puzzl...idy	10,361
Glen B 74 23	Partition Puzzl...loW	10,307
Susume 74 60	Partition Puzzl...i16	11,594
isaksson 12 24	Partition Puzzl...gee	9,950
ReallyRatherDumb 72 58	Partition Puzzl...ene	10,385
Glen B 74 23	Partition Puzzl...k8s	10,949
isaksson 12 24	Partition Puzzl...ume	10,793
Glen B 74 23	Partition Puzzl...sky	11,259


	Top New Users mthienes deanpaopaoyu chromaticiT reevessg@miamioh.edu KyleSowder

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons