![]() |
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein
Status: Closed
|
Summary
Name: | 1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein |
---|---|
Status: | Closed |
Created: | 07/12/2018 |
Points: | 100 |
Expired: | 07/20/2018 - 04:00 |
Difficulty: | Intermediate |
Description: | This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.wikia.com/wiki/Revisiting_puzzle/Spinach_Protein
Oh, Popeye!