![]() |
1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7
Status: Closed
|
Summary
Name: | 1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7 |
---|---|
Status: | Closed |
Created: | 07/09/2018 |
Points: | 100 |
Expired: | 07/16/2018 - 19:00 |
Difficulty: | Intermediate |
Description: | This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
|
Categories: | Pilot |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.wikia.com/wiki/Revisiting_puzzle/Designer_Protein_Top7