puzzle picture
1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7
Status: Active

Summary

Name: 1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7
Status: Active
Created: 07/09/2018
Points: 100
Expires: 07/16/2018 - 19:00
Difficulty: Intermediate
Description: This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!

Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
Categories: Pilot

Top Groups

RankGroupScorePoints
1Beta Folders11,655
2Void Crushers11,641
3Anthropic Dreams11,619
4Go Science11,619
5Hun-Magyar Csapat11,597

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 4 hours 26 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also:
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons