puzzle picture

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Status: Closed

Summary

Name:	1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7
Status:	Closed
Created:	07/09/2018
Points:	100
Expired:	07/16/2018 - 19:00
Difficulty:	Intermediate
Description:	This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else! Sequence: DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
Categories:	Pilot

Top Groups

Rank	Group	Score	Points
1	Beta Folders	11,659	100
2	Void Crushers	11,651	70
3	Anthropic Dreams	11,620	47
4	Go Science	11,619	30
5	Hun-Magyar Csapat	11,618	19

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	LociOiling 1 1	Beta Folders	11,659	100
2	bertro 35 6	Beta Folders	11,656	97
3	dbuske 20 108	Beta Folders	11,625	93
4	Bruno Kestemont 4 4	Go Science	11,619	89
5	reefyrob 6 15	Beta Folders	11,618	86

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	Timo van&n... 74 5	Void Crushers	11,651	100
2	bertro 35 6	Beta Folders	11,646	97
3	LociOiling 1 1	Beta Folders	11,643	93
4	grogar7 61 19	Anthropic Dreams	11,620	89
5	O Seki To 74 29	Hun-Magyar Csapat	11,618	86

Show all >

Need this puzzle? Log in to download.

Comments

Tue, 07/10/2018 - 19:40

#1

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Beta Folders

See also:

https://foldit.wikia.com/wiki/Revisiting_puzzle/Designer_Protein_Top7

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Search Only search fold.it

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics

Player	Puzzle	Score
vakobo 74 460	1573: HIV Prote...d 3	20,267
johnmitch 74 9	1574: Extra Sma...ign	12,135
Technetium 74 921	Beginner Puzzle...ign	10,343
Technetium 74 921	Beginner Puzzle...yle	9,079
KnaveErrant 74 211	Beginner Puzzle...zle	9,001
hansvandenhof 74 217	Beginner Puzzle...nis	10,618
Technetium 74 921	Beginner Puzzle...ity	16,021
jausmh 24 40	Beginner Puzzle...ign	14,164
actiasluna 21 11	Partition Puzzl...una	11,742
silent gene 74 79	Partition Puzzl...r29	10,074
robgee 5 14	Partition Puzzl...oul	10,764
jausmh 24 40	Partition Puzzl...d66	10,732
anthion 69 68	Partition Puzzl...xie	11,790
robgee 5 14	Partition Puzzl...137	10,120
isaksson 12 24	Partition Puzzl...tch	10,433
Glen B 74 23	Partition Puzzl...ing	11,455
guineapig 74 43	Partition Puzzl...170	9,640
Galaxie 2 2	Partition Puzzl...ard	10,020
isaksson 12 24	Partition Puzzl...ran	11,712
Galaxie 2 2	Partition Puzzl...ant	9,845
isaksson 12 24	Partition Puzzl...idy	10,361
Glen B 74 23	Partition Puzzl...loW	10,307
Susume 74 60	Partition Puzzl...i16	11,594
isaksson 12 24	Partition Puzzl...gee	9,950
ReallyRatherDumb 72 58	Partition Puzzl...ene	10,385
Glen B 74 23	Partition Puzzl...k8s	10,949
isaksson 12 24	Partition Puzzl...ume	10,793
Glen B 74 23	Partition Puzzl...sky	11,259


	Top New Users mthienes deanpaopaoyu chromaticiT reevessg@miamioh.edu KyleSowder

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons