puzzle picture
1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin
Status: Closed

Summary

Name: 1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin
Status: Closed
Created: 07/03/2018
Points: 100
Expired: 07/09/2018 - 20:00
Difficulty: Intermediate
Description: Note: This puzzle replaces Puzzle 1542 which was closed early due to a bug.

This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!

Sequence:
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Categories: Pilot

Top Groups

RankGroupScorePoints
1Void Crushers10,405100
2Go Science10,19968
3Beta Folders10,19544
4Anthropic Dreams10,19427
5Marvin's bunch10,17916

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons