puzzle picture
1542: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin
Status: Closed

Summary

Name: 1542: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin
Status: Closed
Created: 07/02/2018
Points: 0
Expired: 07/08/2018 - 23:00
Difficulty: Intermediate
Description: Note: This puzzle was closed early due to a missing filter file resulting in no bonuses being received for forming disulfide bonds. It is superseded by Puzzle 1542b. Players may load their work from this puzzle into the reposted puzzle.

This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!

Sequence:
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Categories:

Top Groups

RankGroupScorePoints
1Void Crushers9,2030
2Go Science9,1660
3Anthropic Dreams9,1110
4Beta Folders9,0760
5L'Alliance Francophone8,7440

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 4 hours 16 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also....

https://foldit.wikia.com/wiki/Revisiting_puzzle/Scorpion_toxin

This is the first of two scorpion toxins, the puzzle 55 toxin.

LociOiling's picture
User offline. Last seen 4 hours 16 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
No bonus for disulfide bonds...

There are four possible disulfide bridges in this puzzle, but there's no bonus for forming them.

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons