puzzle picture
1532: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed

Summary

Name: 1532: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed
Created: 06/11/2018
Points: 100
Expired: 06/18/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,884100
2Contenders10,83673
3Go Science10,77552
4Marvin's bunch10,75736
5Anthropic Dreams10,72124

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Glen B 80 20  11,156100
2fiendish_ghoul 80 4  10,91497
3bertro 53 27 Beta Folders10,87894
4crpainter 80 11 Contenders10,83690
5Bruno Kestemont 5 4 Go Science10,75887


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 52 min 35 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...

http://foldit.wikia.com/wiki/Revisiting_puzzle/Scorpion_toxin

(This is the scorpion toxin from puzzle 69.)

Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons