![]() |
1532: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed
|
Summary
Name: | 1532: Revisiting Puzzle 69: Scorpion Toxin |
---|---|
Status: | Closed |
Created: | 06/11/2018 |
Points: | 100 |
Expired: | 06/18/2018 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
http://foldit.wikia.com/wiki/Revisiting_puzzle/Scorpion_toxin
(This is the scorpion toxin from puzzle 69.)