puzzle picture
1529: Revisiting Puzzle 68: Bos Taurus
Status: Closed

Summary

Name: 1529: Revisiting Puzzle 68: Bos Taurus
Status: Closed
Created: 06/03/2018
Points: 100
Expired: 06/11/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,751100
2Beta Folders10,74976
3Go Science10,73056
4Contenders10,65141
5Void Crushers10,64929

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 7 hours 21 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons