Contest Info

Name: TEST UofGuelph iGEM 2018 oxIT
Type: Template
Owner: RestrictionEndoNykolease
Start Date: 05/21/18
End Date: 06/20/18
Puzzle: Freestyle Design: Variable Length
Description:

Help the University of Guelph iGEM 2018 (Team UofGuelph) solve the structure of the Oxalate:Formate Antiporter (oxIT) for their project this year!

Instructions:
Open the contest then adjust length (number of residues) to 418. Use Recipe AA Edit 1.2 (https://fold.it/portal/recipe/102274) to paste the FASTA AA Sequence below:

Amino Acid FASTA Sequence:
MNNPQTGQSTGLLGNRWFYLVLAVLLMCMISGVQYSWTLYANPVKDNLGVSLAAVQTAFTLSQVIQAGSQPGGGYFVDKFGPRIPLMFGGAMVLAGWTFMGMVDSVPALYALYTLAGAGVGIVYGIAMNTANRWFPDKRGLASGFTAAGYGLGVLPFLPLISSVLKVEGVGAAFMYTGLIMGILIILIAFVIRFPGQQGAKKQIVVTDKDFNSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPYGRSLGLAAGVLTIGVSIQNLFNGGCRPFWGFVSDKIGRYKTMSVVFGINAVVLALFPTIAALGDVAFIAMLAIAFFTWGGSYALFPSTNSDIFGTAYSARNYGFFWAAKATASIFGGGLGAAIATNFGWNTAFLITAITSFIAFALATFVIPRMGRPVKKMVKLSPEEKAVH

Thanks for supporting our team! For more information on our research, please visit http://2018.igem.org/Team:UofGuelph (currently under construction), or last year's page at http://2017.igem.org/Team:U_of_Guelph

Note: Although the "Mutate" function is available, please do not mutate any residues for this contest. Doing so will result in disqualification.


Registered Contestants

Usersort iconScore
LociOiling8160
Madde0
RestrictionEndoNykolease6878

Registered Groups

Groupsort iconScore
Beta Folders8160





Contest List
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons