Contest Info

Name:	TEST UofGuelph iGEM 2018 oxIT
Type:	Template
Owner:	RestrictionEndoNykolease
Start Date:	05/21/18
End Date:	06/20/18
Puzzle:	Freestyle Design: Variable Length
Description:	Help the University of Guelph iGEM 2018 (Team UofGuelph) solve the structure of the Oxalate:Formate Antiporter (oxIT) for their project this year! Instructions: Open the contest then adjust length (number of residues) to 418. Use Recipe AA Edit 1.2 (https://fold.it/portal/recipe/102274) to paste the FASTA AA Sequence below: Amino Acid FASTA Sequence: MNNPQTGQSTGLLGNRWFYLVLAVLLMCMISGVQYSWTLYANPVKDNLGVSLAAVQTAFTLSQVIQAGSQPGGGYFVDKFGPRIPLMFGGAMVLAGWTFMGMVDSVPALYALYTLAGAGVGIVYGIAMNTANRWFPDKRGLASGFTAAGYGLGVLPFLPLISSVLKVEGVGAAFMYTGLIMGILIILIAFVIRFPGQQGAKKQIVVTDKDFNSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPYGRSLGLAAGVLTIGVSIQNLFNGGCRPFWGFVSDKIGRYKTMSVVFGINAVVLALFPTIAALGDVAFIAMLAIAFFTWGGSYALFPSTNSDIFGTAYSARNYGFFWAAKATASIFGGGLGAAIATNFGWNTAFLITAITSFIAFALATFVIPRMGRPVKKMVKLSPEEKAVH Thanks for supporting our team! For more information on our research, please visit http://2018.igem.org/Team:UofGuelph (currently under construction), or last year's page at http://2017.igem.org/Team:U_of_Guelph Note: Although the "Mutate" function is available, please do not mutate any residues for this contest. Doing so will result in disqualification.

Registered Contestants

User	Score
LociOiling	8160
RestrictionEndoNykolease	6878
Madde	0

Registered Groups

Group	Score
Beta Folders	8160