Contest Info

Name: TEST UofGuelph iGEM 2018 oxIT

Type: Template

Owner: RestrictionEndoNykolease

Start Date: 05/21/18

End Date: 06/20/18

Puzzle: Freestyle Design: Variable Length

Description:
Help the University of Guelph iGEM 2018 (Team UofGuelph) solve the structure of the Oxalate:Formate Antiporter (oxIT) for their project this year!

Instructions:
Open the contest then adjust length (number of residues) to 418. Use Recipe AA Edit 1.2 (https://fold.it/portal/recipe/102274) to paste the FASTA AA Sequence below:

Amino Acid FASTA Sequence:
MNNPQTGQSTGLLGNRWFYLVLAVLLMCMISGVQYSWTLYANPVKDNLGVSLAAVQTAFTLSQVIQAGSQPGGGYFVDKFGPRIPLMFGGAMVLAGWTFMGMVDSVPALYALYTLAGAGVGIVYGIAMNTANRWFPDKRGLASGFTAAGYGLGVLPFLPLISSVLKVEGVGAAFMYTGLIMGILIILIAFVIRFPGQQGAKKQIVVTDKDFNSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPYGRSLGLAAGVLTIGVSIQNLFNGGCRPFWGFVSDKIGRYKTMSVVFGINAVVLALFPTIAALGDVAFIAMLAIAFFTWGGSYALFPSTNSDIFGTAYSARNYGFFWAAKATASIFGGGLGAAIATNFGWNTAFLITAITSFIAFALATFVIPRMGRPVKKMVKLSPEEKAVH

Thanks for supporting our team! For more information on our research, please visit http://2018.igem.org/Team:UofGuelph (currently under construction), or last year's page at http://2017.igem.org/Team:U_of_Guelph

Note: Although the "Mutate" function is available, please do not mutate any residues for this contest. Doing so will result in disqualification.