puzzle picture
1520: Revisiting Puzzle 64: Thioredoxin
Status: Closed

Summary

Name: 1520: Revisiting Puzzle 64: Thioredoxin
Status: Closed
Created: 05/14/2018
Points: 100
Expired: 05/21/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Void Crushers11,804100
2Beta Folders11,78776
3Anthropic Dreams11,74656
4Go Science11,74641
5Gargleblasters11,68129

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 40 min 26 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons