puzzle picture
1516: Foldit Player Design with Electron Density
Status: Closed

Summary

Name: 1516: Foldit Player Design with Electron Density
Status: Closed
Created: 05/02/2018
Points: 100
Expired: 05/09/2018 - 23:00
Difficulty: Intermediate
Description: This puzzle features a protein designed by fiendish_ghoul in Puzzle 1331! Last week, we challenged players to try to predict the structure of this protein from the sequence alone, in Puzzle 1511. We have since solved the crystal structure of this protein, and here we are providing players with the refined electron density map at a resolution of 1.54 Å. The crystal's electron density shows that this protein folds up exactly as fiendish_ghoul designed it, with RMSD of 0.9 Å among Cα atoms! Players can load in solutions from Puzzle 1511 to see how their predictions fit in the electron density map, or players can try building into the electron density from an extended chain.

Sequence:
GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science15,135100
2Beta Folders15,12563
3Gargleblasters15,09737
4Anthropic Dreams15,08621
5Marvin's bunch15,01311

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons