puzzle picture
1512: Revisiting Puzzle 61: Designer Protein Top7
Status: Closed

Summary

Name: 1512: Revisiting Puzzle 61: Designer Protein Top7
Status: Closed
Created: 04/23/2018
Points: 100
Expired: 04/30/2018 - 18:00
Difficulty: Intermediate
Description: This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,700100
2Go Science11,69171
3Beta Folders11,67249
4Void Crushers11,66933
5Gargleblasters11,66322

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 3 hours 1 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
See also...
Get Started: Download
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.7 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Search
Only search fold.it
Recommend Foldit
User login
Soloists
Evolvers
Groups
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Microsoft, Adobe, RosettaCommons