![]() |
1512: Revisiting Puzzle 61: Designer Protein Top7
Status: Closed
|
Summary
Name: | 1512: Revisiting Puzzle 61: Designer Protein Top7 |
---|---|
Status: | Closed |
Created: | 04/23/2018 |
Points: | 100 |
Expired: | 04/30/2018 - 18:00 |
Difficulty: | Intermediate |
Description: | This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
http://foldit.wikia.com/wiki/Revisiting_puzzle/Designer_Protein_Top7