|
|
|
1512: Revisiting Puzzle 61: Designer Protein Top7
Status: Closed
|
Summary
| Name: |
1512: Revisiting Puzzle 61: Designer Protein Top7 |
| Status: |
Closed |
| Created: |
04/23/2018 |
| Points: |
100 |
| Expired: |
04/30/2018 - 18:00 |
| Difficulty: |
Intermediate |
| Description: |
This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
|
| Categories: | Overall, Prediction |
|---|
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Comments
|
|
| | |
| | |
| | |
| | |
| Soloists | |
| Evolvers | |
| Groups | |
| Topics | |
|
|
| LociOiling 1 1 | 1545: Sketchboo...op7 | 11,640 | | actiasluna 11 6 | 1546: Extra Lar...ign | 12,521 | | bertro 30 8 | 1547: Sketchboo...ein | 10,948 | | retiredmichael 18 5 | 1548: Unsolved ...136 | 10,520 | | ExecrabLe 72 351 | Beginner Puzzle...ign | 10,280 | | spdenne 72 1881 | Beginner Puzzle...yle | 9,090 | | JasperD 72 66 | Beginner Puzzle...zle | 9,100 | | hexidecimalhack 72 126 | Beginner Puzzle...nis | 9,448 | | hexidecimalhack 72 126 | Beginner Puzzle...ity | 15,716 | | spdenne 72 1881 | Beginner Puzzle...ign | 13,585 |
|
|
| | |
|
| LociOiling 1 1 | 1545: Sketchboo...op7 | 11,640 | | actiasluna 11 6 | 1546: Extra Lar...ign | 12,521 | | bertro 30 8 | 1547: Sketchboo...ein | 10,948 | | retiredmichael 18 5 | 1548: Unsolved ...136 | 10,520 | | ExecrabLe 72 351 | Beginner Puzzle...ign | 10,280 | | spdenne 72 1881 | Beginner Puzzle...yle | 9,090 | | JasperD 72 66 | Beginner Puzzle...zle | 9,100 | | hexidecimalhack 72 126 | Beginner Puzzle...nis | 9,448 | | hexidecimalhack 72 126 | Beginner Puzzle...ity | 15,716 | | spdenne 72 1881 | Beginner Puzzle...ign | 13,585 | |
| Beta Folders | 1545: Sketchboo...op7 | 11,649 | | Gargleblasters | 1546: Extra Lar...ign | 12,521 | | Beta Folders | 1547: Sketchboo...ein | 10,948 | | Beta Folders | 1548: Unsolved ...136 | 10,520 | | Stuyvesant Mole...-18 | Beginner Puzzle...ign | 10,153 | | Void Crushers | Beginner Puzzle...yle | 9,090 | | FoldIt@Netherlands | Beginner Puzzle...zle | 9,100 | | Void Crushers | Beginner Puzzle...nis | 9,448 | | Void Crushers | Beginner Puzzle...ity | 15,716 | | Void Crushers | Beginner Puzzle...ign | 13,585 | |
|
|
http://foldit.wikia.com/wiki/Revisiting_puzzle/Designer_Protein_Top7