puzzle picture

1512: Revisiting Puzzle 61: Designer Protein Top7

Status: Closed

Summary

Name:	1512: Revisiting Puzzle 61: Designer Protein Top7
Status:	Closed
Created:	04/23/2018
Points:	100
Expired:	04/30/2018 - 18:00
Difficulty:	Intermediate
Description:	This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Sequence: DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL
Categories:	Overall, Prediction

Top Groups

Rank	Group	Score	Points
1	Anthropic Dreams	11,700	100
2	Go Science	11,691	71
3	Beta Folders	11,672	49
4	Void Crushers	11,669	33
5	Gargleblasters	11,663	22

Show all >

Top Evolvers

Rank	Player	Group	Score	Points
1	Galaxie 2 2	Anthropic Dreams	11,700	100
2	LociOiling 1 1	Beta Folders	11,672	97
3	toshiue 3 57	Go Science	11,667	93
4	reefyrob 6 15	Beta Folders	11,654	89
5	Bruno Kestemont 4 4	Go Science	11,648	86

Show all >

Top Soloists

Rank	Player	Group	Score	Points
1	ZeroLeak7 32 25	Go Science	11,691	100
2	Timo van&n... 70 5	Void Crushers	11,669	97
3	retiredmichael 15 3	Beta Folders	11,666	93
4	Enzyme 70 272	Gargleblasters	11,663	89
5	LociOiling 1 1	Beta Folders	11,643	86

Show all >

Need this puzzle? Log in to download.

Comments

Thu, 04/26/2018 - 19:17

#1

LociOiling's picture

Offline

Joined: 12/27/2012

Groups: Beta Folders

See also...

http://foldit.wikia.com/wiki/Revisiting_puzzle/Designer_Protein_Top7

Get Started: Download


Windows (7/8/10)	OSX (10.7 or later)	Linux (64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.


	Search Only search fold.it

Recommend Foldit


	User login Username: * Password: * Create new account Request new password

Soloists

Evolvers

Groups

Topics

Player	Puzzle	Score
Bruno Kestemont 4 4	1572b: Quick Mu...ost	18,562
hpaege 70 26	1575: Revisitin...ker	10,104
Galaxie 2 2	1576: Large Mon...ign	13,804
RootBeerSwordsman 70 389	Beginner Puzzle...ign	10,347
Technetium 70 286	Beginner Puzzle...yle	9,079
KnaveErrant 70 212	Beginner Puzzle...zle	9,001
flor-flor	Beginner Puzzle...nis	8,174
Technetium 70 286	Beginner Puzzle...ity	16,021
jausmh 24 44	Beginner Puzzle...ign	14,164
pvc78 70 12	Partition Puzzl...una	11,814
YeshuaLives 70 46	Partition Puzzl...r29	10,129
Bruno Kestemont 4 4	Partition Puzzl...oul	10,910
Bruno Kestemont 4 4	Partition Puzzl...d66	11,269
Bruno Kestemont 4 4	Partition Puzzl...xie	11,922
Bletchley Park 33 20	Partition Puzzl...137	10,266
Bletchley Park 33 20	Partition Puzzl...tch	10,628
Glen B 70 22	Partition Puzzl...ing	11,455
Galaxie 2 2	Partition Puzzl...170	9,812
Galaxie 2 2	Partition Puzzl...ard	10,242
actiasluna 21 11	Partition Puzzl...ran	11,762
Galaxie 2 2	Partition Puzzl...ant	10,017
Bruno Kestemont 4 4	Partition Puzzl...idy	10,530
Galaxie 2 2	Partition Puzzl...loW	10,338
robgee 5 13	Partition Puzzl...i16	11,702
Blipperman 20 33	Partition Puzzl...gee	10,051
Galaxie 2 2	Partition Puzzl...ene	10,494
Bruno Kestemont 4 4	Partition Puzzl...k8s	10,950
hpaege 70 26	Partition Puzzl...ume	10,810
robgee 5 13	Partition Puzzl...sky	11,296


	Top New Users flor-flor KimJongUn alyssajoyh silent gene Knoblerine

Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons